PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold08965-augustus-gene-0.2-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family Dof
Protein Properties Length: 330aa    MW: 35832.5 Da    PI: 8.3887
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold08965-augustus-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.34e-392787262
                                        zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                                                  +++al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  maker-scaffold08965-augustus-gene-0.2-mRNA-1 27 QQQALRCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 87
                                                  7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.8E-332985IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-283085IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.463185IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103369IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MLSKSNCEKM VVITPTTNEW PQQQQQQQQA LRCPRCDSSN TKFCYYNNYS LSQPRHFCKA  60
CKRYWTRGGT LRNVPVGGGC RKNKRVKRPS SASAIDGASS STTPSANTIP PSQPHLDISS  120
STSNHHLNPL FFGLSSNPSD VSLPFPTRFN SRVSNVETVS GYDLQPQLNA LGLGFSSGIL  180
ANDASENDYR NGFNPSSTSN SLLSNYSIFG SSSSTATTSP TIASLLSSNF QQQKLMNGAM  240
KDNRAPNHYQ SLAPFEGLHI ASNSAEAAGI GIKEVKVEDG NSRLDWNNGS CQNNHMEQVG  300
LSDPSLYWNA TNMGAWNDPG NIESSVTSLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007025580.11e-143F-box family protein, putative
TrEMBLA0A061GGE91e-143A0A061GGE9_THECC; F-box family protein, putative
STRINGVIT_10s0003g00040.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.14e-46Dof family protein